DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Klk13

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001034131.2 Gene:Klk13 / 626834 MGIID:3615275 Length:276 Species:Mus musculus


Alignment Length:276 Identity:84/276 - (30%)
Similarity:129/276 - (46%) Gaps:54/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CVTARSEPGLYR----VINGK-------PADL----FSNPWMVIIIERGMMKCGGSLITPRYVLT 79
            |:|.....|:.|    ::||.       |...    .|.||...::.||.:.|||.|:.|::|||
Mouse    10 CLTLALSEGISRDYPKILNGTNGTSGFLPGGYTCLPHSQPWQAALLIRGRLLCGGVLVHPKWVLT 74

  Fly    80 AAHCKSETKSQLTVRLGDYDV------NQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRKNDIA 138
            ||||:   |...||.||.:.:      .||::.  ...||.| |..||    |:|..:  .:||.
Mouse    75 AAHCR---KDGYTVHLGKHALGRVENGEQAMEV--VRSIPHP-EYQVT----PTHLNH--DHDIM 127

  Fly   139 LLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTES-RINSP-VLQQASLTHHH 201
            ||.|::.||...::|::.|...|...:....:      .:|||.|.| ::|.| .||.|::....
Mouse   128 LLELKSPVQLSSHVRTLKLSADDCLPTGTCCR------VSGWGTTTSPQVNYPKTLQCANIELRS 186

  Fly   202 LSYCAQVFGKQLDKSHICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFGP 264
            ...|.||:..::..:.:|..:..|  .:|:|||||||....:        |:|::|:|...|..|
Mouse   187 DEECRQVYPGKITANMLCAGTKEGGKDSCEGDSGGPLICNGK--------LYGIISWGDFPCGQP 243

  Fly   265 T---VYTNVIHFANWI 277
            .   |||.|..:..||
Mouse   244 NRPGVYTRVSKYLRWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 79/263 (30%)
Tryp_SPc 42..280 CDD:238113 80/260 (31%)
Klk13NP_001034131.2 Tryp_SPc 39..262 CDD:238113 77/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.