DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and c1s

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_002941253.2 Gene:c1s / 613055 XenbaseID:XB-GENE-995410 Length:691 Species:Xenopus tropicalis


Alignment Length:275 Identity:80/275 - (29%)
Similarity:121/275 - (44%) Gaps:52/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PQCVTARSEPGLYRVINGKPADLFSNPWMVII--IERGMMKCGGSLITPRYVLTAAHCKSETKSQ 90
            |.|...:|:.. .|:..|..|.....|||:..  ||.|    |||||:.|:||||||.       
 Frog   424 PVCGVHQSDKS-GRIFGGTRAKPGQFPWMIQFTDIELG----GGSLISDRWVLTAAHV------- 476

  Fly    91 LTVRLGDYDVNQAVDCSSYGCIPR---------------PREINVTRTYVPSHYT----NFRKND 136
                     ||:.:..:.:|.:.:               .::|.:...|..:..|    || .||
 Frog   477 ---------VNKKIFPTMFGGVMKFFPNTNLQSQEKRLQAKKIIIHPLYQDNEDTEGQSNF-DND 531

  Fly   137 IALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTHHH 201
            |||::|...|:.|..|..|||.........|.:..:     .|||:||.|.::..||.||::...
 Frog   532 IALVQLTKKVKLGSCISPICLPRRGLAPVVNEVATI-----AGWGKTEKRESAVNLQFASISLSS 591

  Fly   202 LSYCAQVFGKQ--LDKSHICVASSTG-STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG 263
            :..|.:..|.:  ...:.:|..|..| .:|.|||||||.......|. ::.:.|:||:|...|..
 Frog   592 MDKCKKATGGKGYFTPNMLCAGSDVGKDSCNGDSGGPLMFTDPQDSS-KMYMAGIVSWGPRDCGT 655

  Fly   264 PTVYTNVIHFANWIE 278
            ..:||.|.::.:|||
 Frog   656 YGLYTKVDNYLDWIE 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 74/259 (29%)
Tryp_SPc 42..280 CDD:238113 76/261 (29%)
c1sXP_002941253.2 CUB 21..131 CDD:238001
FXa_inhibition 145..173 CDD:405372
CUB 177..288 CDD:238001
PHA02927 301..>436 CDD:222943 3/12 (25%)
Tryp_SPc 436..669 CDD:214473 74/259 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.