DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and cela1.4

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001025669.1 Gene:cela1.4 / 595061 XenbaseID:XB-GENE-22064324 Length:265 Species:Xenopus tropicalis


Alignment Length:294 Identity:90/294 - (30%)
Similarity:128/294 - (43%) Gaps:58/294 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QLLLLIALVFLKVQGQPHLLDPQCVTARSEPGLY----RVINGKPADLFSNPWMVII--IERGMM 65
            |||||.|||.             |.....:.|..    ||:.|..|...|.||.|.:  :..|..
 Frog     3 QLLLLAALVL-------------CGRCDEDIGFIEDNGRVVGGINAAKNSWPWQVSLQYLSSGYW 54

  Fly    66 --KCGGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSH 128
              .||.|||....|||||||...:.| ..|.|||:::|.......|        |:|:|..   .
 Frog    55 YHTCGASLIRANRVLTAAHCVDRSVS-FRVVLGDHNINANDGTEQY--------ISVSRII---K 107

  Fly   129 YTNFRKN------DIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRI 187
            :.|:..|      |||:|.|.::....:.:| :..|..|    ..:|.|......||||||.:..
 Frog   108 HANWNTNNIAAGYDIAVLHLASSATLNNYVR-LAQLPAD----GVVLANNHGCVVTGWGRTSTGG 167

  Fly   188 N-SPVLQQA--SLTHHHLSYCAQVFGKQLDKSHICVASSTG--STCQGDSGGPLTARVRIGSERR 247
            : :.:||||  |:..|.....:..:|..:..:.:| |...|  |:|.|||||||...|. |..: 
 Frog   168 SLAAILQQAPLSVVAHSTCSSSSWWGSSVKTTMVC-AGGDGVRSSCNGDSGGPLNCAVN-GVYQ- 229

  Fly   248 VILFGVVSYGAVHCFG----PTVYTNVIHFANWI 277
              :.|:||:|:.....    |:|:|.|..:..||
 Frog   230 --VHGIVSFGSASGCNISRKPSVFTRVSAYIAWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 78/254 (31%)
Tryp_SPc 42..280 CDD:238113 79/255 (31%)
cela1.4NP_001025669.1 Tryp_SPc 29..263 CDD:238113 79/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.