DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG34458

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:281 Identity:74/281 - (26%)
Similarity:123/281 - (43%) Gaps:51/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLIT 73
            :||:|:.|:...     :|   |...|     |:|.|:.|.....|..|.:...|...||||||:
  Fly    12 ILLLAVTFVHSD-----MD---VAEES-----RIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLIS 63

  Fly    74 PRYVLTAAHC-KSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYV-PSHYTNFRKND 136
            ...::||||| ..:...|:...:|..|::..          ..:..|:.:..: |.:....:..|
  Fly    64 DTMIVTAAHCTMGQNPGQMKAIVGTNDLSAG----------NGQTFNIAQFIIHPRYNPQSQDFD 118

  Fly   137 IALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSP-VLQQASLTHH 200
            ::|::|.:.|..|..:::|.|...|..::::.:..:     :|:|.....:..| .|:.|.:...
  Fly   119 MSLIKLSSPVPMGGAVQTIQLADSDSNYAADTMAMI-----SGFGAINQNLQLPNRLKFAQVQLW 178

  Fly   201 HLSYCAQVFGKQLDKSHICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG 263
            ...||.......|....:|....:|  |:||||||||||...:        ||||||:|    ||
  Fly   179 SRDYCNSQNIPGLTDRMVCAGHPSGQVSSCQGDSGGPLTVDGK--------LFGVVSWG----FG 231

  Fly   264 ------PTVYTNVIHFANWIE 278
                  |.:||.|....:||:
  Fly   232 CGAKGRPAMYTYVGALRSWIK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 65/246 (26%)
Tryp_SPc 42..280 CDD:238113 66/248 (27%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 65/246 (26%)
Tryp_SPc 32..254 CDD:238113 66/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.