DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG34409

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:282 Identity:78/282 - (27%)
Similarity:110/282 - (39%) Gaps:74/282 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERG------MMKCGGSLITPRYVLTAAHCKSETKSQLT---VRLG 96
            |::.|..|.....||:..|..|.      ..:|.||||:..:::|||||.....|.|.   ||||
  Fly   249 RLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVSDLELSHVRLG 313

  Fly    97 DYDVNQAVDCSSYGCIP-RPREINVTRTYVPSHYTNFRKNDIALLRLETTVQYGDNIRSICL-LM 159
            ..|          |..| ...::.|...|....|.    |||||||:.:|   ......||| ..
  Fly   314 SQD----------GATPFAIEQVIVHPNYDQPKYA----NDIALLRINST---NGTFTPICLPFN 361

  Fly   160 GDYTWSSNILKNLVKFNTTGW--GRTESR--------------INSPVLQQASLTHHHLSYCAQV 208
            |..|..:.::..:..  ..||  |.||:.              |..|::...|        ||..
  Fly   362 GPITLGNRLIGQIGV--AAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTS--------CAIA 416

  Fly   209 FGK---------QLDKSHICV-ASSTGSTCQGDSGGPL----TARVRIGSERRVILFGVVSYGAV 259
            :..         .:..:|:|. .......|:||||||.    |:.| .|:..|..:.|:|::|..
  Fly   417 YASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGV-FGTSGRYTIIGIVAFGPT 480

  Fly   260 HCFG----PTVYTNVIHFANWI 277
            .| |    |.|||.|..|::||
  Fly   481 LC-GVTTIPGVYTLVSSFSDWI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 76/280 (27%)
Tryp_SPc 42..280 CDD:238113 77/281 (27%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 76/280 (27%)
Tryp_SPc 252..501 CDD:238113 75/277 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.