DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG34436

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster


Alignment Length:263 Identity:80/263 - (30%)
Similarity:120/263 - (45%) Gaps:33/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCK 84
            ||...|||..|..      :.|:.|.   .:||.|||.:::... ..|.|:||...:|:|:|.|.
  Fly    17 QGSAQLLDQNCAE------VSRLSND---IIFSRPWMALVLLPN-KTCSGALIHKYFVITSASCV 71

  Fly    85 SETKSQLTVRLGDYDVNQ--AVDCSSYGCIPRPREINVTRTYVPSHY--TNFRKNDIALLRLETT 145
            . .:.:..||||...:.|  .|..||       .:.:|...|:...|  :|| ::|||||.|:..
  Fly    72 F-NQERAIVRLGQLSIKQEHIVSYSS-------DDYHVQSAYIHRFYEKSNF-EHDIALLELQND 127

  Fly   146 VQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTHHHLSYCAQVFG 210
            |.|..:||.|||.:......:.:.|   ::.|..||..|..| .|..:.:.:.|.....|...|.
  Fly   128 VLYKAHIRPICLWLDKSDIDTQMFK---RYETFRWGIDEKYI-LPAAKTSKIKHISQVKCENAFK 188

  Fly   211 KQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVH-CFGPTVYTNVIHFA 274
            .....||||......|.|. ::|.||..::|..::.|..|||:.|||... |    :||:|..:.
  Fly   189 LYPQNSHICAGYKNKSKCV-ETGSPLFKKIRYYTKIRYTLFGIQSYGESRTC----LYTDVTKYI 248

  Fly   275 NWI 277
            :||
  Fly   249 DWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 72/240 (30%)
Tryp_SPc 42..280 CDD:238113 73/241 (30%)
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 71/231 (31%)
Tryp_SPc 40..251 CDD:214473 69/229 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.