DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP011918

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_001689276.1 Gene:AgaP_AGAP011918 / 5667954 VectorBaseID:AGAP011918 Length:259 Species:Anopheles gambiae


Alignment Length:260 Identity:72/260 - (27%)
Similarity:107/260 - (41%) Gaps:61/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMK-CGGSLITPRYVLTAAHCKSETK--------SQLTVRLG 96
            |::||..|.....|:.|.:....... |||::|...::||||||.:..|        ..||...|
Mosquito    31 RIVNGLNAVSGQFPYQVSLTSATYQHFCGGAIIGNHWILTAAHCLTGRKPAEVIAVVGALTSARG 95

  Fly    97 --DYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNF----RKNDIALLRLETTVQYGDNIRSI 155
              :|||.|.:                       .:.||    ::|||||:|.:.::.:...:..:
Mosquito    96 GYNYDVEQFI-----------------------LHPNFNEWTQQNDIALVRTKWSISFNTAVFPV 137

  Fly   156 CLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPV--LQQASLTHHHLSYCAQVFGK----QLD 214
             .:...||.::..:.      .:|||.|...:..|.  ||..:|.......|::.|.|    .:.
Mosquito   138 -KMARTYTPANRAVL------ASGWGLTTLSVPKPADRLQYVALRTISNEDCSERFRKLQNRAIT 195

  Fly   215 KSHICVAS-STGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG-PTVYTNVIHFANWI 277
            .|.:|..| :...||.|||||||   |..|.     |.|:||:|.....| |.||..|..|..||
Mosquito   196 PSILCTFSRNEQGTCMGDSGGPL---VEDGE-----LVGIVSWGIPCAVGYPDVYVRVSSFRAWI 252

  Fly   278  277
            Mosquito   253  252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 70/258 (27%)
Tryp_SPc 42..280 CDD:238113 71/259 (27%)
AgaP_AGAP011918XP_001689276.1 Tryp_SPc 31..252 CDD:214473 70/258 (27%)
Tryp_SPc 32..252 CDD:238113 69/257 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.