DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP005705

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_001688714.1 Gene:AgaP_AGAP005705 / 5667318 VectorBaseID:AGAP005705 Length:311 Species:Anopheles gambiae


Alignment Length:263 Identity:77/263 - (29%)
Similarity:121/263 - (46%) Gaps:51/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVING---KPADLFSNPWMV---IIIERGMMKCGGSLITPRYVLTAAHCKSETKSQLTVRLGDYD 99
            |:.||   .|.|:   |::|   :.:|:|...|||.|::..:|||:|.| .|.::.:||.||..|
Mosquito    72 RINNGVIVGPTDV---PYIVGVLVSVEQGTYFCGGVLVSRTHVLTSATC-VEGQTSITVLLGASD 132

  Fly   100 VNQAVDCSSYGCIPRPREINVTRTYV-PSHYTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYT 163
            :.:|.|.           :.|:...| |...:.|:.||:|:|.|....::.|.|:     :....
Mosquito   133 ITRAQDF-----------VVVSHVRVHPDFSSFFQANDLAILTLSRMPRFNDQIQ-----LARLP 181

  Fly   164 WSSNILKNLVKFNTT--GWGRTESRINS--PVLQQASLTHHHLS--YCAQVFGKQLDKSHICVAS 222
            ..|.:.::.....||  |||.|.|....  |:.|..|:....:|  .|...|...|..|::|.:|
Mosquito   182 RRSQVGESFTNAWTTISGWGETASNTGEALPMQQLRSVRSQVISNFSCTISFPLYLRSSNVCTSS 246

  Fly   223 STGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCF---------GPTVYTNVIHFANWIE 278
            ..|:.|.||.|||:|. |....:..||        |:|.:         .|.|:|.|..:.||||
Mosquito   247 DGGAPCVGDEGGPVTI-VEEDGQSTVI--------AIHSYTYSRGCTRSWPAVHTRVTDYLNWIE 302

  Fly   279 LHT 281
            ::|
Mosquito   303 IYT 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 73/257 (28%)
Tryp_SPc 42..280 CDD:238113 75/259 (29%)
AgaP_AGAP005705XP_001688714.1 Tryp_SPc 72..301 CDD:214473 73/257 (28%)
Tryp_SPc 73..302 CDD:238113 73/257 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.