DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and MASP1

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_011511291.1 Gene:MASP1 / 5648 HGNCID:6901 Length:735 Species:Homo sapiens


Alignment Length:312 Identity:82/312 - (26%)
Similarity:134/312 - (42%) Gaps:75/312 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KVQGQ--PHLLDPQC-VTARSEPGLY-RVINGKPADLFSNPWMVIIIERGMMKC-------GGSL 71
            ||.|:  |..| |:| ..:||.|.|. |:|.|:.|:....||..:|:.....:.       .|:|
Human   430 KVLGRSLPTCL-PECGQPSRSLPSLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKWFGSGAL 493

  Fly    72 ITPRYVLTAAH-CKSE---------TKSQLTVRLGDYDVNQ---AVDCSSYGCIPRPREINVTRT 123
            ::..::||||| .:|:         :|..:||.||.:||..   ||:.|:...:..| :.|:   
Human   494 LSASWILTAAHVLRSQRRDTTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARVVLHP-DFNI--- 554

  Fly   124 YVPSHYTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWG------- 181
                  .|: .:||||::|:..|..|.::..:||...:....:..:..||    .|||       
Human   555 ------QNY-NHDIALVQLQEPVPLGPHVMPVCLPRLEPEGPAPHMLGLV----AGWGISNPNVT 608

  Fly   182 -----RTESRINSPVLQQASL-----THHHLSYCAQVFGKQLDKSHICVASSTG--STCQGDSGG 234
                 .:.:|..|.|||...|     .....||.::.....:.::..|.....|  .||.|||||
Human   609 VDEIISSGTRTLSDVLQYVKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGG 673

  Fly   235 PLTARVRIGSERRVILFGVVSYGAVHCFGPT---------VYTNVIHFANWI 277
            ...  :.....:|.::.|:||:|     ||.         |||.|.::.:|:
Human   674 AFV--IFDDLSQRWVVQGLVSWG-----GPEECGSKQVYGVYTKVSNYVDWV 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 70/283 (25%)
Tryp_SPc 42..280 CDD:238113 70/284 (25%)
MASP1XP_011511291.1 CUB 35..144 CDD:238001
FXa_inhibition 160..188 CDD:291342
CUB 192..301 CDD:278839
Sushi 308..369 CDD:278512
CCP 374..439 CDD:153056 4/8 (50%)
Tryp_SPc 456..718 CDD:214473 70/283 (25%)
Tryp_SPc 457..718 CDD:238113 69/282 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.