DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and PRSS1

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:255 Identity:68/255 - (26%)
Similarity:108/255 - (42%) Gaps:54/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVD 105
            :::.|...:..|.|:.| .:..|...||||||..::|::|.||   .||::.||||::::.    
Human   248 KIVGGYNCEENSVPYQV-SLNSGYHFCGGSLINEQWVVSAGHC---YKSRIQVRLGEHNIE---- 304

  Fly   106 CSSYGCIPRPREINVTRTYVPSHYTNFRK---NDIALLRLETTVQYGDNIRSICLLMGDYTWSSN 167
                  :....|..:....:..|....||   |||.|::|.:.......:.:|.|........:.
Human   305 ------VLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTK 363

  Fly   168 ILKNLVKFNTTGWGRTESR----------INSPVLQQASLTHHHLSYCAQVFGKQLDKSHICVAS 222
            .|       .:|||.|.|.          :::|||.||.        |...:..::..:..||..
Human   364 CL-------ISGWGNTASSGADYPDELQCLDAPVLSQAK--------CEASYPGKITSNMFCVGF 413

  Fly   223 STG--STCQGDSGGPLTARVRIGSERRVILFGVVSY--GAVHCFGPTVYTNVIHFANWIE 278
            ..|  .:||||||||:....:        |.||||:  |......|.|||.|.::..||:
Human   414 LEGGKDSCQGDSGGPVVCNGQ--------LQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 66/252 (26%)
Tryp_SPc 42..280 CDD:238113 68/254 (27%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 66/252 (26%)
Tryp_SPc 249..467 CDD:238113 68/254 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.