DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and zgc:112038

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:293 Identity:93/293 - (31%)
Similarity:129/293 - (44%) Gaps:55/293 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLLI--ALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVII--IERGMMKCG 68
            |||.|  ||..|.|.||..|.:..              .|..|...|.||...|  |......||
Zfish    13 LLLNIAGALCQLDVCGQAPLNNNN--------------GGDDAVAGSWPWQASIHRISPEDHICG 63

  Fly    69 GSLITPRYVLTAAHCKSET-KSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYV---PSHY 129
            ||||...:||:||||...| .:.:.:.||          ..:.....|.||:.|.|.:   |.:.
Zfish    64 GSLINKDWVLSAAHCFMITATANIKIFLG----------RQFQTGSNPNEISRTLTQIVIHPDYS 118

  Fly   130 TNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTES---RINSPV 191
            |..:.||||||||.::|.:.|.||.:||...|..::..     .|...|||.:..|   ::.: |
Zfish   119 TTTQNNDIALLRLSSSVTFTDYIRPVCLASADSVFAGG-----TKSWITGWDKHRSSDIQVTN-V 177

  Fly   192 LQQASLTHHHLSYCAQVFGKQLDKSHICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVV 254
            ||:..|.....:.|...:...:..:.||...:.|  ..||||||||:.::    :..|.|..|:|
Zfish   178 LQEVQLPVVSNTECNADYKGIITDNMICAGINEGGKDACQGDSGGPMVSQ----NGSRWIQSGIV 238

  Fly   255 SYGAVHCFG----PTVYTNVIHFANWI--ELHT 281
            |:|. .| |    |.:||.|..:.:||  ||.|
Zfish   239 SFGR-EC-GLPRYPGIYTRVSQYQSWITSELRT 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 77/250 (31%)
Tryp_SPc 42..280 CDD:238113 80/254 (31%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 77/247 (31%)
Tryp_SPc 37..263 CDD:238113 77/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.