DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Prss44

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_008764869.1 Gene:Prss44 / 501060 RGDID:1560940 Length:373 Species:Rattus norvegicus


Alignment Length:268 Identity:76/268 - (28%)
Similarity:116/268 - (43%) Gaps:69/268 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHC------------KSETKSQLTV 93
            |::.||||.:...||.|.:.......||||||:..:|:|||||            :::..|.::|
  Rat   112 RIVGGKPAPIRKWPWQVSLQVHKQHICGGSLISKWWVMTAAHCVYGHLDYVVSMGEADLWSSMSV 176

  Fly    94 RLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRKNDIALLRLETTVQYGDNIRSICL- 157
            ::...|:....|.|            |.||.|         :||||:.|...|.|..||:.:|: 
  Rat   177 KIPVQDIIVHQDYS------------VMRTIV---------HDIALVLLAFPVNYSVNIQPVCIP 220

  Fly   158 ------LMGDYTWSSNILKNLVKFNTTGWGRT-ESRINSPVLQQASLTHHHLSYCAQVF----GK 211
                  ..|...|            .||||:| |...:|.||::..|:......|.|:.    |:
  Rat   221 EKSFLVQPGTLCW------------VTGWGKTIERGRSSRVLREVDLSIIRHERCNQILKDITGR 273

  Fly   212 ---QLDKSHIC-VASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHC--FG-PTVYTN 269
               .:.:..:| .....|..||||||||:....    .:..:..|:||:| :.|  .| |.:||.
  Rat   274 IFTLVQEGGVCGYNKKGGDACQGDSGGPMVCEF----NKTWVQVGIVSWG-LGCGRIGYPGIYTE 333

  Fly   270 VIHFANWI 277
            |.::.:||
  Rat   334 VSYYRDWI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 74/266 (28%)
Tryp_SPc 42..280 CDD:238113 75/267 (28%)
Prss44XP_008764869.1 Tryp_SPc 112..341 CDD:214473 74/266 (28%)
Tryp_SPc 113..341 CDD:238113 73/265 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.