DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and masp2

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001011037.1 Gene:masp2 / 496446 XenbaseID:XB-GENE-1007491 Length:687 Species:Xenopus tropicalis


Alignment Length:287 Identity:85/287 - (29%)
Similarity:129/287 - (44%) Gaps:50/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVII---IERGMMKCGGSLITPRYVLTAAHC- 83
            |.:..|.| ..|......|::.|:.|::...||.|.|   .|||    ||:|:...::|||||. 
 Frog   426 PPICVPDC-GKRKPAAAGRIVGGEFANVGEFPWQVFINANNERG----GGALLLDNWILTAAHVV 485

  Fly    84 -KSETKSQLTVRLGDYDVNQAVDCSSY--GCIPRPREINVTRTYVPSHYTNFRKNDIALLRLETT 145
             ..:..|.:.:::|......    |:|  |.   |..:.:...|.|.||    .|||||::|:..
 Frog   486 YSYDDLSSILIKMGFLSTQD----SNYIRGW---PEAVFIHEGYKPGHY----NNDIALIKLKNK 539

  Fly   146 VQYG-DNIRSICLLMGD--YTWSSNILKNLVKFNTTGWGRTESRINSPVLQ--QASLTHHHLSYC 205
            |... ::|..|||...:  |..|.....|.|.. ..|||.||::.:|..|:  :.::..|  |.|
 Frog   540 VPLSEESILGICLPTKEKSYHISHKDDDNHVGL-VAGWGLTEAQRSSRKLRFVEVNIVDH--STC 601

  Fly   206 AQVFGKQLDKSH------ICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHC- 261
            ...:.| ||..:      ||.....|  .:|.|||||.|.  ......::..:.|:||:| |.| 
 Frog   602 KAEYAK-LDAQYIVTENMICAGFEIGVKDSCAGDSGGALA--FMNAESKKWFVGGIVSWG-VGCG 662

  Fly   262 ----FGPTVYTNVIHFANWIELHTKKN 284
                :|  |||.|.::.:|||...:.|
 Frog   663 VARQYG--VYTKVTNYLDWIEKTIQAN 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 77/260 (30%)
Tryp_SPc 42..280 CDD:238113 79/262 (30%)
masp2NP_001011037.1 CUB 30..139 CDD:238001
FXa_inhibition 145..180 CDD:317114
CUB 184..294 CDD:238001
CCP 299..361 CDD:153056
CCP 365..430 CDD:153056 1/3 (33%)
Tryp_SPc 443..680 CDD:214473 77/260 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.