DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and sdhaf4

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001008179.1 Gene:sdhaf4 / 493541 XenbaseID:XB-GENE-1007482 Length:118 Species:Xenopus tropicalis


Alignment Length:39 Identity:10/39 - (25%)
Similarity:15/39 - (38%) Gaps:4/39 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 LLMGDYTWSS-NILKNLVKFNTTGWGRTESRINSPVLQQ 194
            |.|....|:| ..|.:..:.|..|   |:..:..|...|
 Frog    30 LKMWSGLWNSCRALSHNSQHNIKG---TKQPLKKPTTPQ 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 10/39 (26%)
Tryp_SPc 42..280 CDD:238113 10/39 (26%)
sdhaf4NP_001008179.1 DUF1674 76..118 CDD:311723
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.