DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP009218

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_001238239.1 Gene:AgaP_AGAP009218 / 4578285 VectorBaseID:AGAP009218 Length:193 Species:Anopheles gambiae


Alignment Length:198 Identity:62/198 - (31%)
Similarity:90/198 - (45%) Gaps:38/198 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLIALVFLKVQGQPHLLDPQ-CVTARSEPGLYRVIN----GKPADLFSNPWMVII-IERGMMKC 67
            :|||||.... |...||||.: |       |:.|:.|    |...:|...||:..| ...|...|
Mosquito     6 ILLIALHGAH-QATAHLLDLEGC-------GMNRMQNNETLGNNDNLGQLPWIASIKSSSGQHIC 62

  Fly    68 GGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVN----QAVDCSSYG-CIPRPREINVTRTYVPS 127
            |||||:.|||||||||           ||..|:.    :..||...| |.....:|.:.||....
Mosquito    63 GGSLISKRYVLTAAHC-----------LGHNDLAFVQLRKKDCDESGVCTLAKEDIPIERTIGHD 116

  Fly   128 HYTN-FRKNDIALLRLETTVQYGDNIRSICLLMG-DYTWSSNILKNLVKFNTTGWGRTESRINSP 190
            .|.. .:.:||||:||.....:..::|.|||.|| :|..:::      |:.....|:..:.:|:.
Mosquito   117 SYNKPVQSHDIALVRLTRDASFNSDVRPICLPMGPEYQTTAS------KYFVAPRGQDYASLNTD 175

  Fly   191 VLQ 193
            .::
Mosquito   176 TIE 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 50/165 (30%)
Tryp_SPc 42..280 CDD:238113 49/164 (30%)
AgaP_AGAP009218XP_001238239.1 Tryp_SPc 39..>193 CDD:304450 48/157 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.