DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CLIPA19

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_001237509.2 Gene:CLIPA19 / 4577382 VectorBaseID:AGAP003245 Length:356 Species:Anopheles gambiae


Alignment Length:295 Identity:84/295 - (28%)
Similarity:130/295 - (44%) Gaps:46/295 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FLKVQGQPHLL--DPQC-VTARSEPGLYRVING----KPADLFSNPWMVII-IER-----GMMKC 67
            |:....:.|:|  .|.| |.|.::      :.|    :|.|.   ||..:| .|:     | ..|
Mosquito    80 FICCPDKRHVLPEPPHCGVRAATQ------LTGAQLTQPDDY---PWTALIEYEKPDGTTG-FHC 134

  Fly    68 GGSLITPRYVLTAAHCKSETKSQLTVR---LGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHY 129
            ||:||...::||||||.|..::...|.   ||::|::..:||:...|...|.|..|::..|...|
Mosquito   135 GGTLINQGHILTAAHCVSSLRAGWKVHRVLLGEWDLSSVLDCAYNVCNNPPIEAKVSKIIVHDGY 199

  Fly   130 T----NFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNT-TGWGRTESRINS 189
            .    :| .:||||:|.|....:.|.|..|||.:.|.....||...   |:| .|||:::|....
Mosquito   200 DAQNGSF-NHDIALIRFEELANFPDTIVPICLPIADSIPWENITDG---FSTVVGWGKSQSTAGV 260

  Fly   190 PVLQQASLTHHHLSYCAQV--FGKQLDKSHICV--ASSTGSTCQGDSGGPLTARVRIGSERRVIL 250
            ....:.:|...:...|:.:  :.:::..|.:|.  ..|....|..|:||.|....|    |...|
Mosquito   261 TKKLKLNLKVRNFRECSSLLEWPEKMQPSQLCALWERSNRKICSADAGGGLAWFYR----RFHYL 321

  Fly   251 FGVVSYGAVHCFG---PTVYTNVIHFANWIELHTK 282
            .||.......|..   |.|:.||.::.|||..:.|
Mosquito   322 IGVAGSDEQKCGSGDVPGVFVNVSYYMNWIRDNIK 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 74/260 (28%)
Tryp_SPc 42..280 CDD:238113 76/262 (29%)
CLIPA19XP_001237509.2 CLIP 37..84 CDD:197829 1/3 (33%)
Tryp_SPc 106..354 CDD:238113 76/259 (29%)
Tryp_SPc 106..351 CDD:214473 74/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.