DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and zgc:92313

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001002596.1 Gene:zgc:92313 / 436869 ZFINID:ZDB-GENE-040718-339 Length:309 Species:Danio rerio


Alignment Length:262 Identity:74/262 - (28%)
Similarity:116/262 - (44%) Gaps:35/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PGLYRVINGKPADLFSNPWMVIII-ERGMMKCGGSLITPRYVLTAAHC--KSETKSQLTVRLGDY 98
            |.:.|::.|..|...:.||.|.|. |:....|||::|:..:||:||||  .....|...:..|..
Zfish    30 PMINRIVGGSSAADGAWPWQVDIQGEKSKHVCGGTIISENWVLSAAHCFPNPNDISGYLIYAGRQ 94

  Fly    99 DVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFR-KNDIALLRLETTVQYGDNIRSICLLMGDY 162
            .:|        |..|......::|..||..||:.: ..||||:.|.|...|.:.|:.:||...:.
Zfish    95 QLN--------GWNPDETSHRISRVVVPLGYTDPQLGQDIALVELATPFVYTERIQPVCLPYANV 151

  Fly   163 TWSSNILKNLVKFNTTGWGRTESRIN----SPVLQQASLTHHHLSYCAQVF----GKQLD--KSH 217
            .::|:     ::...||||.....:.    .| ||:..:.......|..:|    .:.:|  ...
Zfish   152 EFTSD-----MRCMITGWGDIREGVALQGVGP-LQEVQVPIIDSQICQDMFLTNPTENIDIRPDM 210

  Fly   218 ICVASSTG--STCQGDSGGPLTARVRIGS--ERRVILFGVVSYGAVHCFGPTVYTNVIHFANWIE 278
            :|.....|  .:|||||||||..::..||  :..::.||:   |......|.||..|..|.|:|:
Zfish   211 MCAGFQQGGKDSCQGDSGGPLACQISDGSWVQAGIVSFGL---GCAEANRPGVYAKVSSFTNFIQ 272

  Fly   279 LH 280
            .|
Zfish   273 TH 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 71/253 (28%)
Tryp_SPc 42..280 CDD:238113 71/255 (28%)
zgc:92313NP_001002596.1 Tryp_SPc 34..271 CDD:214473 71/253 (28%)
Tryp_SPc 35..274 CDD:238113 71/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.