DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG11313

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:260 Identity:92/260 - (35%)
Similarity:130/260 - (50%) Gaps:33/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIER---GMM---KCGGSLITPRYVLTAAHC--------KSETKSQL 91
            ::..|....|....|||::..|   |..   .|.||||..|||:|||||        |.:...::
  Fly   115 QITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRV 179

  Fly    92 TVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHY-TNFRKNDIALLRLETTVQYGDNIRSI 155
            :||||:::.:..|||.:..|:|.|.:|.|....:...: |....|||||:||...|.|..:||.:
  Fly   180 SVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLAREVAYSPSIRPV 244

  Fly   156 CL--LMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTHHHLSYCAQVFGK--QLDKS 216
            ||  .:|...|.|.     ..|...|||||.:..:|||..:..:|:.....|.:.:..  .|..|
  Fly   245 CLPSTVGLQNWQSG-----QAFTVAGWGRTLTSESSPVKMKLRVTYVEPGLCRRKYASIVVLGDS 304

  Fly   217 HICV-ASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHC---FGPTVYTNVIHFANWI 277
            |:|. ..|.|.:|.|||||||.|    ..|...:|.|:||:| ::|   |.|.|||||:.:..||
  Fly   305 HLCAEGRSRGDSCDGDSGGPLMA----FHEGVWVLGGIVSFG-LNCGSRFWPAVYTNVLSYETWI 364

  Fly   278  277
              Fly   365  364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 90/258 (35%)
Tryp_SPc 42..280 CDD:238113 92/259 (36%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 92/259 (36%)
Tryp_SPc 116..364 CDD:214473 90/257 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.