DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG5909

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster


Alignment Length:263 Identity:92/263 - (34%)
Similarity:137/263 - (52%) Gaps:21/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VTARSEPGLYRVINGKPADLFSNPWMVI----IIERGMMKCGGSLITPRYVLTAAHCKSETKSQL 91
            ||.....|..:|..||.|.....||:.:    |.:....:||||||:.|::||||||..:....:
  Fly   119 VTNCGNKGNPKVSGGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHILTAAHCIIDQPEVI 183

  Fly    92 TVRLGDYDVNQAVDCSSYG-----CIPRPREINVTRTYVPSHYTNFR-KNDIALLRLETTVQYGD 150
            .||||::|:....||...|     |||...|..:.:..|..:|.:.: .:|:|:::|:..|:...
  Fly   184 AVRLGEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKISHDVAIIKLDRVVKEKS 248

  Fly   151 NIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTHHHLSYCAQVFGK-QLD 214
            :|:.:||.:..   .|..|.....|...|||.||....:..||||.:|...|:.|.|.:.| ::.
  Fly   249 HIKPVCLPIDQ---KSQELDFDQSFFVAGWGGTEKETVATKLQQALITRKSLNECRQYYNKGEVS 310

  Fly   215 KSHICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG---PTVYTNVIHFA 274
            .:||| |:.||  .|||||||||:..:.|..:..||:.:||||:|...| |   |.|:.:||...
  Fly   311 DNHIC-ATGTGIKHTCQGDSGGPVFFKHRFKNTYRVVQYGVVSFGGRLC-GQNQPGVFASVIDML 373

  Fly   275 NWI 277
            .||
  Fly   374 PWI 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 87/251 (35%)
Tryp_SPc 42..280 CDD:238113 89/252 (35%)
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 87/251 (35%)
Tryp_SPc 132..379 CDD:238113 88/250 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.