DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and grass

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:254 Identity:85/254 - (33%)
Similarity:130/254 - (51%) Gaps:20/254 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVII----IERGMMKCGGSLITPRYVLTAAHCKSETKSQL-TVRLGDYDV 100
            ||.||....|.|.|||.::    .......|||::|:.||:||||||....::.| .:|||::.:
  Fly   118 RVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQNDLYEIRLGEHRI 182

  Fly   101 NQAVDCSSYG----CIPRPREINVTRTYVPSHY-TNFRKNDIALLRLETTVQYGDNIRSICLLMG 160
            :...||...|    |.|....:.:.:..:...| .....:|||||:|..:|.:..:|:.|||.:.
  Fly   183 STEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKLNRSVPFQKHIKPICLPIT 247

  Fly   161 DYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTHHHLSYCAQVFGKQLDKSHICV-ASST 224
            |..  ....:.:..:..||||.||:..:|.||.||::.....|.|:|.:.:.:..|.:|| ....
  Fly   248 DEL--KEKAEQISTYFVTGWGTTENGSSSDVLLQANVPLQPRSACSQAYRRAVPLSQLCVGGGDL 310

  Fly   225 GSTCQGDSGGPLTARVRIGSE--RRVILFGVVSYGAVHCFG----PTVYTNVIHFANWI 277
            ..:|:|||||||.|..:...|  .:::.||:||.|.|.| |    |.:||||..:..||
  Fly   311 QDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVVTC-GQISLPGLYTNVGEYVQWI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 83/252 (33%)
Tryp_SPc 42..280 CDD:238113 84/253 (33%)
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 83/251 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.