DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG11836

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:260 Identity:84/260 - (32%)
Similarity:122/260 - (46%) Gaps:29/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHC-KSETKSQ 90
            |..|..:..|   .|::.|||..:...|||..|:..|...|||||:|..|||:|||| |...||:
  Fly    85 DCDCGFSNEE---IRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSK 146

  Fly    91 LTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRKNDIALLRLETTVQYGDNIRSI 155
            :.|..||:|  |.:...|.........:...:::.|..|    .||||||||...:.:...|:.|
  Fly   147 IRVIFGDHD--QEITSESQAIQRAVTAVIKHKSFDPDTY----NNDIALLRLRKPISFSKIIKPI 205

  Fly   156 CLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSP-VLQQASLTHHHLSYCAQVFGK--QLDKSH 217
            ||...:|..:..|      ....|||||......| ::.|..:....::.|.....|  ::..|.
  Fly   206 CLPRYNYDPAGRI------GTVVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSM 264

  Fly   218 ICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG----PTVYTNVIHFANWIE 278
            :|....:..:|||||||||.    :.:..:..:.|:||:| |.| |    |.||:.|..|..||:
  Fly   265 LCAGRPSMDSCQGDSGGPLL----LSNGVKYFIVGIVSWG-VGC-GREGYPGVYSRVSKFIPWIK 323

  Fly   279  278
              Fly   324  323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 79/243 (33%)
Tryp_SPc 42..280 CDD:238113 80/245 (33%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 80/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.