DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG7142

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:264 Identity:64/264 - (24%)
Similarity:106/264 - (40%) Gaps:68/264 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SNPWMVII----IERGMMK-CGGSLITPRYVLTAAHCKSETKS--QLTVRLGDYDVNQAVDCSSY 109
            |.|::|.|    .::|::. |.|::|...::||||||.|..::  ...:..|.:|:         
  Fly    90 SAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDI--------- 145

  Fly   110 GCIPRPREINVTRTYVPSHYTNFRKNDIALLRLETTVQY-----GDNIRSICLLMGDYTWSSNIL 169
                              |......::|.:..::..|::     |.|...|.|:   ||....:.
  Fly   146 ------------------HDQKGEASNIQMRHIDYYVRHELYLGGVNPYDIALI---YTKEPLVF 189

  Fly   170 KNLVKFNTT--------------GWGRTESRI--NSP-VLQQASLTHHHLSYCAQVF---GKQLD 214
            ...|:..|.              |||......  |.| .||:|::....:..|.|:.   |..|.
  Fly   190 DTYVQPATLPEQDAQPEGYGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLH 254

  Fly   215 KSHICVASSTG--STCQGDSGGPLTAR-VRIGSERRVILFGVVSYGAVHC---FGPTVYTNVIHF 273
            ::::|....||  |.|..||||||..: .....|:..|:.|:||:|.:.|   ..|:|:..|..|
  Fly   255 ETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAF 319

  Fly   274 ANWI 277
            ..||
  Fly   320 TEWI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 62/262 (24%)
Tryp_SPc 42..280 CDD:238113 64/264 (24%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 64/264 (24%)
Tryp_SPc 84..323 CDD:214473 62/262 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.