DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG14892

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster


Alignment Length:409 Identity:90/409 - (22%)
Similarity:133/409 - (32%) Gaps:150/409 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AGAVQLLLLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWM----VIIIERG 63
            |.:...|..:.|:.|....:....|..|..||..|   |:|.|...:....||.    ::....|
  Fly    45 ATSTATLSWLCLLLLLPSSRQFETDCGCRPARRGP---RIIAGAATNEGQFPWQASLELLHPSLG 106

  Fly    64 MMK--CGGSLITPRYVLTAAHCKSETKSQL------TVRLGDYDVNQAVDCSSYGCIPRPREINV 120
            .:.  ||..||...::|:||||.......|      ||.||::|  :.|:..:...||      |
  Fly   107 FLGHWCGAVLIHQYWILSAAHCVHNDLFNLPIPPLWTVVLGEHD--RDVESGNEQRIP------V 163

  Fly   121 TRTYVPSHYTNFRKNDIALLRLE--TTVQYGDNIRSICL--LMG---DYTWSSNI---------- 168
            .:..:...|.|| |:|:.|::|.  ..:....|||.|||  |:.   |...|..:          
  Fly   164 EKIVMHHRYHNF-KHDVVLMKLSKPADLTRASNIRRICLPFLLAESPDQAQSETVSPPSSADEDV 227

  Fly   169 ----------------------------------LKNLVKFN----------------------- 176
                                              :|.|:...                       
  Fly   228 LIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRR 292

  Fly   177 -------------------------------------TTGWGRTESRINSPVLQQASLTH---HH 201
                                                 .||||:  :.|:..:..|...|.   |.
  Fly   293 NDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAFVDCVATGWGK--ANISGDLSNQLLKTQVPLHQ 355

  Fly   202 LSYCAQVFGK--QLDKSHICVA--SSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYG---AV 259
            ...|...:|.  .:...|:|..  :..|.||.|||||||  :.|:..:...||.||.|:|   |:
  Fly   356 NGRCRDAYGSFVNIHGGHLCAGKLNGEGGTCVGDSGGPL--QCRLSRDGPWILVGVTSFGSGCAL 418

  Fly   260 HCFGPTVYTNVIHFANWIE 278
            ..| |.|||...::..|||
  Fly   419 EGF-PDVYTRTSYYMKWIE 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 78/368 (21%)
Tryp_SPc 42..280 CDD:238113 80/370 (22%)
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 78/368 (21%)
Tryp_SPc 81..438 CDD:238113 80/370 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.