DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and ea

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:287 Identity:96/287 - (33%)
Similarity:138/287 - (48%) Gaps:49/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LDPQCVTARSEPGLYRVINGKPADLFSNPWMVIII------ERGMMKCGGSLITPRYVLTAAHCK 84
            |..||....|.    |:..|....:...|||.:|.      ::| ..||||||:.|||:||:||.
  Fly   116 LPGQCGNILSN----RIYGGMKTKIDEFPWMALIEYTKSQGKKG-HHCGGSLISTRYVITASHCV 175

  Fly    85 S----ETKSQLT-VRLGDYDVNQAVDC-----SSYGCIPRPREINVTRT-----YVPSHYTNFRK 134
            :    .|..:|: ||||::|.|...||     ....|.|...::.|.||     |:|:  :..:.
  Fly   176 NGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPA--SKNQV 238

  Fly   135 NDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTH 199
            ||||||||...|:|.|.:|.|||.: |....|..... :..:..|||:||....|.:..:|::..
  Fly   239 NDIALLRLAQQVEYTDFVRPICLPL-DVNLRSATFDG-ITMDVAGWGKTEQLSASNLKLKAAVEG 301

  Fly   200 HHLSYCAQVFGKQ---LDKSHICVASSTG-STCQGDSGGPLTARVRIGSERRVI-----LFGVVS 255
            ..:..|..|:..|   |:.:.:|.....| .:|:|||||||     ||.:...:     |.||||
  Fly   302 FRMDECQNVYSSQDILLEDTQMCAGGKEGVDSCRGDSGGPL-----IGLDTNKVNTYYFLAGVVS 361

  Fly   256 YGAVHCFG----PTVYTNVIHFANWIE 278
            :|...| |    |.|||.|..:.:||:
  Fly   362 FGPTPC-GLAGWPGVYTLVGKYVDWIQ 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 90/269 (33%)
Tryp_SPc 42..280 CDD:238113 91/271 (34%)
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 90/269 (33%)
Tryp_SPc 128..389 CDD:238113 91/271 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.