DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG3916

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:284 Identity:87/284 - (30%)
Similarity:134/284 - (47%) Gaps:43/284 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVII--IERGMMK--CG 68
            :|.|..::.:..||   |.|  .||:.:|....  |||......:.|:.|.:  ..||..:  ||
  Fly     3 VLQLFCMLLILRQG---LAD--VVTSTTESPTR--INGGQRVNETVPFQVSLQMQRRGRWQHFCG 60

  Fly    69 GSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSY--GCIPRPREINVTRTYVPSHYTN 131
            ||:::.::|||||||..:.|.:        ||:..|...::  |.:   |...||:...|.:..|
  Fly    61 GSIVSGQHVLTAAHCMEKMKVE--------DVSVVVGTLNWKAGGL---RHRLVTKHVHPQYSMN 114

  Fly   132 FR-KNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVL--Q 193
            .| .|||||:::....:...:..|..|:.|     |:.:...|....||||.|....:|..|  |
  Fly   115 PRIINDIALVKVTPPFRLERSDISTILIGG-----SDRIGEKVPVRLTGWGSTSPSTSSATLPDQ 174

  Fly   194 QASLTHHHLSY--CAQVFGKQLDKSHICVASSTG-STCQGDSGGPLTARVRIGSERRVILFGVVS 255
            ..:|.:..:|.  |.|. |.::.::.||..:..| ..|.|||||||   :|.|.:..::  |:||
  Fly   175 LQALNYRTISNEDCNQK-GFRVTRNEICALAVQGQGACVGDSGGPL---IRPGKQPHLV--GIVS 233

  Fly   256 YGAVHCF--GPTVYTNVIHFANWI 277
            ||:..|.  .|.|||.|..|..:|
  Fly   234 YGSSTCAQGRPDVYTRVSSFLPYI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 77/249 (31%)
Tryp_SPc 42..280 CDD:238113 78/250 (31%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 77/250 (31%)
Tryp_SPc 31..260 CDD:238113 78/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.