DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG17404

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:305 Identity:89/305 - (29%)
Similarity:138/305 - (45%) Gaps:58/305 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GAVQLLLLIALVFL-KVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSN---PWMVIIIER-- 62
            |..:.||||.:|.| .|.|:.:...|...|.      :|::.|  ||:...   |:.|.:..|  
  Fly     2 GLTEQLLLIGVVALGGVFGRLNSRQPSGYTP------HRIVGG--ADIPPGEHVPYQVSLQYRTR 58

  Fly    63 -GMMK-CGGSLITPRYVLTAAH-CKSETKSQLTVRLGDYDVNQAVDCS---SYGCIPRPREINVT 121
             |.|. ||||:|.|..:||||| |:....|:::|..|...:|:....|   ||...|:.:|: ||
  Fly    59 GGQMHFCGGSIIAPNRILTAAHCCQGLNASRMSVVAGIRGLNEKGSRSQVLSYSIHPKYQEL-VT 122

  Fly   122 RTYVPSHYTNFRKNDIALLRLETTVQYGDNIRSICLLMGDY-TWSSNILKNLVKFNTTGWGRT-- 183
                         :|:|:|.::..::..::..|..    :| :...:.:...|....||||..  
  Fly   123 -------------SDLAVLSIKPPLKLNNSTISAI----EYRSQGKDFVGGGVPVTLTGWGLRLP 170

  Fly   184 -----ESRINSP-VLQQASLTHHHL--SYCAQVFGKQLDKSHICVASSTGSTCQGDSGGPLTARV 240
                 ...:|.| |||:  :::|.:  |.|.....:.:..:.||........|.|||||||....
  Fly   171 VPFPFLDNVNYPNVLQR--MSYHTISNSECRNAGMESVTDTEICARGPFRGACSGDSGGPLVMES 233

  Fly   241 RIGSERRVILFGVVSYGAVHC---FGPTVYTNVIHFANWIELHTK 282
            :.|.::    .|:||||.|.|   ..|.|||.|..|::||...||
  Fly   234 KNGLQQ----VGIVSYGLVVCGLYISPDVYTRVSTFSDWIGNQTK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 74/260 (28%)
Tryp_SPc 42..280 CDD:238113 75/262 (29%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 74/260 (28%)
Tryp_SPc 35..269 CDD:238113 73/259 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.