DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Prss45

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001008864.1 Gene:Prss45 / 408244 RGDID:1303021 Length:330 Species:Rattus norvegicus


Alignment Length:243 Identity:72/243 - (29%)
Similarity:107/243 - (44%) Gaps:35/243 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREI 118
            ||.|.:.......|||:||...:|::||||....|..| |.||...:..:..       |...:|
  Rat    62 PWEVSLQIENEHVCGGALIDQSWVVSAAHCIQGNKEYL-VMLGSSTLQPSGS-------PWALKI 118

  Fly   119 NVTRTYVPSHY--TNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWG 181
            .|....:...|  .||.::|||||.|||.|.:...|:.|||...::.     ||..:|...||||
  Rat   119 PVGDIIMHPKYWGQNFIRSDIALLCLETPVTFNKYIQPICLPEHNFN-----LKVGMKCWVTGWG 178

  Fly   182 RTESRINSPVLQQASLTHHHLSY-----CAQVFGKQ---------LDKSHICVASSTGSTCQGDS 232
            :.:...::.:.:...|....:|.     |.:||.|:         :.|:.||..:...:.|.||.
  Rat   179 QAKQHPSAKLTRSLELWEAEVSIVDNKNCDRVFHKKTFYPQVIPLIRKNMICTTNHRENPCYGDP 243

  Fly   233 GGPLTARVRIGSERRVILFGVVSYGAVHCFGP--TVYTNVIHFANWIE 278
            ||||...|    ..|.||.|:.|:.......|  :|||.:..:..||:
  Rat   244 GGPLACEV----HGRWILAGIFSWEKACTKAPNLSVYTRIDKYTGWIK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 70/240 (29%)
Tryp_SPc 42..280 CDD:238113 72/243 (30%)
Prss45NP_001008864.1 Tryp_SPc 57..289 CDD:238113 72/243 (30%)
Tryp_SPc 57..286 CDD:214473 70/240 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336745
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.