DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Tmprss11c

DIOPT Version :10

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001399454.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:431 Species:Rattus norvegicus


Alignment Length:275 Identity:80/275 - (29%)
Similarity:127/275 - (46%) Gaps:46/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETKS 89
            ||:..|......||.::|..|:.|:....||...:.:..:.:||.:||:..:::|||||...:.:
  Rat   183 LLNTCCGRRTITPGGHKVAGGQDAEEGEWPWQASLQQNNVHRCGATLISNSWLITAAHCFVRSAN 247

  Fly    90 QLTVRLGDYDVNQAVDCSSYG-CIPRPREINVTRTYV-------PSHYTNFRKNDIALLRLETTV 146
            .     .|:.|       |:| .:.:|:.....::.|       |:|     .||||::||.:.|
  Rat   248 P-----KDWKV-------SFGFLLSKPQAQRAVKSIVIHENYSYPAH-----NNDIAVVRLSSPV 295

  Fly   147 QYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSP-VLQQASLTHHHLSYC--AQV 208
            .|.:|||..||......:..|  .::|   .||||..:|..:|| :||:..:.......|  .:.
  Rat   296 LYENNIRRACLPEATQKFPPN--SDVV---VTGWGTLKSDGDSPNILQKGRVKIIDNKTCNSGKA 355

  Fly   209 FGKQLDKSHICVASSTG--STCQGDSGGPLTARVRIGSERRVILF--GVVSYGAVHCF---GPTV 266
            :|..:....:|.....|  ..|||||||||     :..:.:.|.|  |:||:|. .|.   .|.|
  Rat   356 YGGVITPGMLCAGFLEGRVDACQGDSGGPL-----VSEDSKGIWFLAGIVSWGD-ECALPNKPGV 414

  Fly   267 YTNVIHFANWIELHT 281
            ||.|.|:.:||...|
  Rat   415 YTRVTHYRDWISSKT 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 42..280 CDD:238113 74/255 (29%)
Tmprss11cNP_001399454.1 SEA 62..161 CDD:460188
Tryp_SPc 200..428 CDD:238113 74/255 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.