DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG6865

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:269 Identity:67/269 - (24%)
Similarity:122/269 - (45%) Gaps:55/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHC------KSETKSQLTVRLGDYD 99
            :::.|..|:....|:||.::.||...|||::|:.|::|||.||      :....:|:...:|.:.
  Fly    34 KIVGGSEAERNEMPYMVSLMRRGGHFCGGTIISERWILTAGHCICNGLQQFMKPAQIQGVVGLHS 98

  Fly   100 VNQAVDCSSYGCIPRPREINVTRTYV---PSHYTNFRKNDIALLRLETTVQYGDNIRSICL---- 157
            :.:.::....|    |..:.|....:   |.:..|..|:|||||.|...:::..:|:..|:    
  Fly    99 IREYLNGIGNG----PDALRVDFKNIVPHPQYDCNDVKHDIALLELVQPIRFSSHIQPSCVGSEE 159

  Fly   158 ----LMGDYTWSSNILKNLVKFNTTGWGRTE----SRINSPVLQQASLTHHHLSYCAQVF---GK 211
                |..:|.            ..:|||.|.    ....|.||::|::...:...|.:.:   ||
  Fly   160 GHRSLEQEYG------------TVSGWGWTHENQAENDRSDVLRKATVKIWNNEACERSYRSLGK 212

  Fly   212 Q--LDKSHICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG---PTVYTN 269
            .  :.::.:|.....|  .:|..||||||.::     |..::  ||||.| :.|..   |.:||.
  Fly   213 SNTIGETQLCAGYENGQIDSCWADSGGPLMSK-----EHHLV--GVVSTG-IGCARPGLPGIYTR 269

  Fly   270 VIHFANWIE 278
            |..:.:|::
  Fly   270 VSKYVSWMQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 66/266 (25%)
Tryp_SPc 42..280 CDD:238113 67/268 (25%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 66/265 (25%)
Tryp_SPc 35..280 CDD:238113 67/268 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.