DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG4914

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:269 Identity:83/269 - (30%)
Similarity:110/269 - (40%) Gaps:67/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHC-KSETKSQLTVRLGDYDVNQAV 104
            |::.|....:...|||..:.......|||:||..||||||||| |......:.|..|::|     
  Fly   127 RIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFGEHD----- 186

  Fly   105 DCSSYGCIPRPREINVTRTYVPS-HYTNFRKNDIALLRLETTVQYGDNIRSIC---------LLM 159
            .|:..   .||....|.|.:... .::|| .||||||||...|.....||.||         |.:
  Fly   187 RCNDK---ERPETRFVLRAFSQKFSFSNF-DNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFV 247

  Fly   160 GDYTWSSNILKNLVKFNTTGWGRTE---------SRINSPVLQ------QASLTHHHLSYCAQVF 209
            |            .|...||||..:         ..:..|||.      |.:.|.          
  Fly   248 G------------TKAIATGWGTLKEDGKPSCLLQEVEVPVLDNDECVAQTNYTQ---------- 290

  Fly   210 GKQLDKSHICVA-SSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFGPT---VYT 268
             |.:.|:.:|.. ...|  .:||||||||| .|:| ..::|....|:||:|. .|..|.   |||
  Fly   291 -KMITKNMMCSGYPGVGGRDSCQGDSGGPL-VRLR-PDDKRFEQIGIVSWGN-GCARPNYPGVYT 351

  Fly   269 NVIHFANWI 277
            .|..:.:||
  Fly   352 RVTKYLDWI 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 81/267 (30%)
Tryp_SPc 42..280 CDD:238113 82/268 (31%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 81/267 (30%)
Tryp_SPc 128..363 CDD:238113 82/268 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.