DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG33460

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:295 Identity:71/295 - (24%)
Similarity:117/295 - (39%) Gaps:73/295 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VQLLLLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFS---NPWMVIIIERGMMKC 67
            :.||....||........:.|..||...|.|              ||   .||..::...|.:.|
  Fly     7 ISLLASYMLVIYSDSVSANYLYEQCGLMREE--------------FSTSLGPWTALLHTDGSIFC 57

  Fly    68 GGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNF 132
            .|:|||..::||||.|  ...:.:.||||::        ..|     |.|:  ...::..::..:
  Fly    58 AGTLITDVFILTAASC--IRPNAVKVRLGEF--------GRY-----PNEL--PEDHLVHYFLMY 105

  Fly   133 R-------KNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRIN-- 188
            |       .|:|.||:|...||..|.|..:|:::.    ..|...:.::|....| ..:|.::  
  Fly   106 RLFNNESLANNIGLLKLTKRVQITDYIMPVCIVLN----PQNQQLSTMRFIGNAW-MEDSNVSLT 165

  Fly   189 ---SPVLQQAS---LTHHHL--SYCAQVFGKQLDKSHICVASSTGS--TCQGDSGGPLTARVRIG 243
               .|::.|:.   .|:..|  .:||   |.|            |:  :|.|.:|..|....|..
  Fly   166 KELRPIVIQSKPKMCTNLDLYTQFCA---GHQ------------GNLRSCDGLTGSALIQNSRYM 215

  Fly   244 SERRVILFGVVSYGAVHCFGPTVYTNVIHFANWIE 278
            ::.|.|.||:.:...:.|.....||:|:.|..||:
  Fly   216 NKYRHIQFGIATVNDMDCEESQGYTDVLKFYWWIQ 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 60/257 (23%)
Tryp_SPc 42..280 CDD:238113 62/259 (24%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 60/244 (25%)
Tryp_SPc 44..249 CDD:214473 58/241 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.