DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG33465

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:289 Identity:89/289 - (30%)
Similarity:132/289 - (45%) Gaps:41/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLIT 73
            |.||.||.  .||...|||.:|    .:|.....||.......:.|||..|.:.....|.|:|:.
  Fly     7 LALIGLVL--CQGLAQLLDKKC----HDPKTSENINFNHGATETAPWMASIYKNNQFICDGTLVH 65

  Fly    74 PRYVLTAAHCKSETKSQLTVRLGDY----DVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRK 134
            ..:|||||.|.|: .|||.|..|.|    |.:|..:...||            ..|...::|||.
  Fly    66 KLFVLTAASCISK-DSQLYVLFGMYNQYRDASQFFNNEQYG------------VAVALQHSNFRP 117

  Fly   135 ----NDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKN--LVKFNTTGWGRTESRINSPVLQ 193
                |||.||||...|.:..:||.||:::      .:::|:  ..:|...||.:..:..:|.|.|
  Fly   118 NNGVNDIGLLRLYGEVTHYAHIRPICIIL------DHVVKSAPFERFEGFGWQQQGTEASSQVRQ 176

  Fly   194 QASLTHHHLSYC---AQVFGKQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVS 255
            ...|:......|   .|:.  .:::...|..:...|.|:.:||.||||....|.:...:..|:||
  Fly   177 TVYLSQKKPFECHRNGQLL--PINEGQFCAGNRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVS 239

  Fly   256 YGAVHCFGPTVYTNVIHFANWIELHTKKN 284
            ||:..|...:|||:|:.|.:|| .:|.:|
  Fly   240 YGSELCSPTSVYTDVVAFKDWI-YNTVRN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 73/248 (29%)
Tryp_SPc 42..280 CDD:238113 75/250 (30%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 73/239 (31%)
Tryp_SPc 46..261 CDD:214473 71/235 (30%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.