DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG32374

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:253 Identity:67/253 - (26%)
Similarity:109/253 - (43%) Gaps:37/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVD 105
            |::|||.......|:...:.......||..::..|::|||.|||.....:.|||.|.....:...
  Fly    73 RIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHCKIGNPGRYTVRAGSTQQRRGGQ 137

  Fly   106 CSSYGCIPRPREINVTRTYVPSHYTNF-RKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNIL 169
            ..           :|.:|....:|:.: .|||:.:::|:|.:..|..::.:.|       .|...
  Fly   138 LR-----------HVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKL-------PSTRT 184

  Fly   170 KNLVK-FNTTGWGRTESRINS--PVLQQASLTHHHLSYCAQVF---GKQLDKSHICVASSTGSTC 228
            |...| :..:|||.|.:...:  ..|:...:.....:.|.|.:   |.::.|..||.......||
  Fly   185 KRFPKCYLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRKNRDTC 249

  Fly   229 QGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG---PTVYTNVIHFANWIELHTKK 283
            .|||||||   |..|     :|:|:.|:| :.|..   |.||.||:.:..||:...||
  Fly   250 SGDSGGPL---VHNG-----VLYGITSFG-IGCASAKYPGVYVNVLQYTRWIKKVAKK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 63/245 (26%)
Tryp_SPc 42..280 CDD:238113 64/247 (26%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 63/245 (26%)
Tryp_SPc 74..295 CDD:238113 64/247 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.