DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and pik3ip1

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_938188.1 Gene:pik3ip1 / 386643 ZFINID:ZDB-GENE-031030-14 Length:263 Species:Danio rerio


Alignment Length:90 Identity:19/90 - (21%)
Similarity:34/90 - (37%) Gaps:23/90 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPR 114
            :|...:.::::..|::                .|.|..|..:|....||...|....|...|:..
Zfish     1 MFGRLYFMLLLSVGLV----------------DCLSVVKDCITNNGEDYRGTQQKTSSGSTCLSW 49

  Fly   115 PREINV----TRTYVPSHYTNFRKN 135
             |.:|:    ::|.|..|  ||.:|
Zfish    50 -RSLNLKFKDSQTGVGDH--NFCRN 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 19/90 (21%)
Tryp_SPc 42..280 CDD:238113 19/90 (21%)
pik3ip1NP_938188.1 KR 24..101 CDD:214527 14/51 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..263
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575893
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.