DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG1299

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster


Alignment Length:262 Identity:87/262 - (33%)
Similarity:131/262 - (50%) Gaps:43/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVII----IERGMMKCGGSLITPRYVLTAAHCKSETKSQLT-VRLGDYDV 100
            :::.|:.:...:.||:.::    ......||||:|||.|:|||||||   .:..|. ||||::|:
  Fly   260 KIVGGEVSRKGAWPWIALLGYDDPSGSPFKCGGTLITARHVLTAAHC---IRQDLQFVRLGEHDL 321

  Fly   101 NQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRKN---DIALLRLETTVQYGDNIRSICLLMGDY 162
            :...:....       :||:.| || ||....|:|   |:|:|.||..|::...|..|||     
  Fly   322 STDTETGHV-------DINIAR-YV-SHPDYNRRNGRSDMAILYLERNVEFTSKIAPICL----- 372

  Fly   163 TWSSNI-LKNLVKFN--TTGWGRT-ESRINSPVLQQASLTHHHLSYCAQVFGK--------QLDK 215
            ..::|: .|:.|.:.  ..|||:| |...::.||.:..:..:....|.|.:.|        |.||
  Fly   373 PHTANLRQKSYVGYMPFVAGWGKTMEGGESAQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDK 437

  Fly   216 SHIC--VASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFGPT---VYTNVIHFAN 275
            :.:|  |.|....||||||||||........:.|..|.|||||| :.|..|.   ||::..:|.:
  Fly   438 AVLCAGVLSGGKDTCQGDSGGPLMLPEPYQGQLRFYLIGVVSYG-IGCARPNVPGVYSSTQYFMD 501

  Fly   276 WI 277
            ||
  Fly   502 WI 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 85/260 (33%)
Tryp_SPc 42..280 CDD:238113 87/261 (33%)
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855
Tryp_SPc 260..503 CDD:214473 85/260 (33%)
Tryp_SPc 261..503 CDD:238113 85/259 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.