DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and KLK1

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_002248.1 Gene:KLK1 / 3816 HGNCID:6357 Length:262 Species:Homo sapiens


Alignment Length:266 Identity:73/266 - (27%)
Similarity:106/266 - (39%) Gaps:44/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETKSQLTVR-- 94
            |..:.|...|::.|...:..|.||...:......:|||.|:..::|||||||.|:.......|  
Human    15 TGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHN 79

  Fly    95 -LGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSH-------YTNFRKNDIALLRL-ETTVQYGD 150
             ..|.:..|.|..|.  ..|.|   ....:.:.:|       |:    :|:.|||| |......|
Human    80 LFDDENTAQFVHVSE--SFPHP---GFNMSLLENHTRQADEDYS----HDLMLLRLTEPADTITD 135

  Fly   151 NIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTE-SRINSP-VLQQASLTHHHLSYCAQVFGKQL 213
            .::.:.|...:....|..|       .:|||..| ...:.| .||...|.......|.:...:::
Human   136 AVKVVELPTEEPEVGSTCL-------ASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKV 193

  Fly   214 DKSHICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG----PTVYTNVIH 272
            ....:||....|  .||.|||||||..        ..:|.||.|:|.|.| |    |:|...|:.
Human   194 TDFMLCVGHLEGGKDTCVGDSGGPLMC--------DGVLQGVTSWGYVPC-GTPNKPSVAVRVLS 249

  Fly   273 FANWIE 278
            :..|||
Human   250 YVKWIE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 68/254 (27%)
Tryp_SPc 42..280 CDD:238113 70/256 (27%)
KLK1NP_002248.1 Tryp_SPc 25..257 CDD:238113 70/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.