DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG13430

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:259 Identity:76/259 - (29%)
Similarity:116/259 - (44%) Gaps:52/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSE-TKSQ-LTVRLGDYDVNQA 103
            |::.|....:...|..|.:.......|||::|:|..:||||||..| :|.| ..:|.|..|..:.
  Fly    31 RIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEYSKPQYYVIRAGSSDWTKG 95

  Fly   104 VDCSSY----GCIPRPREINVTRTYVPSHYTNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTW 164
               .||    ..||.|...:.||          ..||||:::|:..:.|..:||.|.|     ..
  Fly    96 ---GSYIRVKKIIPHPEFHDPTR----------MNNDIAIVQLQQPLVYSQDIRPISL-----AT 142

  Fly   165 SSNILKNLVKFNTTGWGRT-------ESRINSPVLQQASLTHHHL---SYCAQ-VFGK-QLDKSH 217
            |.:|:....:...:|||.|       |.|:...|:        ||   :.||: .||. .:..:.
  Fly   143 SKDIIMPTAQLFVSGWGSTSISQMQPEKRLRYTVV--------HLRDQNQCARNYFGAGTVTNTM 199

  Fly   218 ICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVS--YGAVHCFGPTVYTNVIHFANWI 277
            .|..:..|  .:|||||||||...:    :.|:.|:|:||  :|..:...|.:||.|..:.:||
  Fly   200 FCAGTQAGGRDSCQGDSGGPLVTSI----DGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 74/257 (29%)
Tryp_SPc 42..280 CDD:238113 75/258 (29%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 74/257 (29%)
Tryp_SPc 32..262 CDD:238113 75/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.