DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG30283

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:277 Identity:106/277 - (38%)
Similarity:153/277 - (55%) Gaps:28/277 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VQLLLLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGS 70
            |.||...::|.|..:....|..| |.|.....  ::::.|..|.:.|.|||.:::..|...|||:
  Fly    10 VVLLAASSVVVLGSESGSFLEHP-CGTVPISQ--FKILGGHNAPVASAPWMAMVMGEGGFHCGGT 71

  Fly    71 LITPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTN---- 131
            |||.|:|||:|||.:  ..:|.||||..:                ||....:..|.:.:.:    
  Fly    72 LITNRFVLTSAHCIA--NGELKVRLGVLE----------------REAEAQKFAVDAMFVHTDYY 118

  Fly   132 FRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQAS 196
            |.::|:|||||...|.|.|||..||||:....  .||.:::|||.|.|||:||||.:|.:||:.|
  Fly   119 FDQHDLALLRLAKRVHYSDNISPICLLLDPLV--KNIDEHIVKFRTYGWGKTESRSSSRMLQKTS 181

  Fly   197 LTHHHLSYCAQVF-GKQLDKSHICVASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVH 260
            |.:.|.|.||:.: .:|::::|||..|:..:||.|||||||||.|.....:.|..|||.|:|...
  Fly   182 LFNLHRSECAKQYPHQQINRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHAD 246

  Fly   261 CFGPTVYTNVIHFANWI 277
            |...||:|||:...:||
  Fly   247 CSKATVFTNVMTHLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 95/240 (40%)
Tryp_SPc 42..280 CDD:238113 97/241 (40%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 95/240 (40%)
Tryp_SPc 43..266 CDD:238113 97/241 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472838
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.730

Return to query results.
Submit another query.