DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and PRSS41

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:345 Identity:102/345 - (29%)
Similarity:143/345 - (41%) Gaps:105/345 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGA-GAVQLLLLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGK--------PA-----DLF 51
            ||| ||:.|.||:|...|   |:|..|.    ..::.||..|...|.        ||     :|.
Human     1 MGARGALLLALLLARAGL---GKPGELG----ALQAGPGAARRPGGGGREGHFLCPAESQEEELL 58

  Fly    52 SN----------------------PWMVIIIERGMMKCGGSLITPRYVLTAAHC--KSETKSQLT 92
            |.                      ||...:..|...:|||||::.|:||:||||  |....|:.|
Human    59 SEACGHREIHALVAGGVESARGRWPWQASLRLRRRHRCGGSLLSRRWVLSAAHCFQKHYYPSEWT 123

  Fly    93 VRLGDYDV-----NQAVDCSSY---GCIPRPREINVTRTYVPSHYTNFRKNDIALLRLETTVQYG 149
            |:||:...     |.....|.|   ..|..|..:.|.|            ||||||||.::|.|.
Human   124 VQLGELTSRPTPWNLRAYSSRYKVQDIIVNPDALGVLR------------NDIALLRLASSVTYN 176

  Fly   150 DNIRSICLLMGDYT-------WSSNILKNLVKFNTTGWGRTESRINSPV-----LQQASLTHHHL 202
            ..|:.||:....:.       |            .||||.. |...:|:     |::|.:|..:.
Human   177 AYIQPICIESSTFNFVHRPDCW------------VTGWGLI-SPSGTPLPPPYNLREAQVTILNN 228

  Fly   203 SYCAQVFGKQLDKSHI-----CVASSTGS--TCQGDSGGPLTARVRIGSERRVILFGVVSYGAVH 260
            :.|..:|.:...:|.|     |..:..||  ||:|||||||... :.|...:|   |:||:| :.
Human   229 TRCNYLFEQPSSRSMIWDSMFCAGAEDGSVDTCKGDSGGPLVCD-KDGLWYQV---GIVSWG-MD 288

  Fly   261 CFGPT---VYTNVIHFANWI 277
            |..|.   ||||:..:.:||
Human   289 CGQPNRPGVYTNISVYFHWI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 85/302 (28%)
Tryp_SPc 42..280 CDD:238113 86/303 (28%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.