DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG14760

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster


Alignment Length:242 Identity:66/242 - (27%)
Similarity:104/242 - (42%) Gaps:41/242 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VIIIERGMMKCGGSLITPRYVLTAAHC----KSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPRE 117
            |:..:.|.:.||.::|..||:|:||||    ::.:.::|.|.:|::|:     .||:       |
  Fly   294 VLTKKHGKVFCGAAIIHHRYLLSAAHCFLGPETNSAAKLRVVVGEHDL-----ASSF-------E 346

  Fly   118 INVTRTYVP---------SHYTNFRKNDIALLRLETTVQYGDNIRSICLLM--GDYTWSSNILKN 171
            ...|:.|..         |..:...|||||:|:....:.:..::...||.:  |:......:..:
  Fly   347 TFATQRYDLDALILHEDFSQASGQPKNDIAMLKTRMAIVWSQHVGPACLPLQPGEDGQKLPLAGH 411

  Fly   172 LVKFNTTGWGRTESRINSPV---LQQASLTHHHLSYCAQVFGKQ--LDKSHICVASSTGSTCQGD 231
            .|.  ..|||.|.  ...|.   |.:|:|.......|.|.....  |.....|..:....|||.|
  Fly   412 QVV--AAGWGTTS--YGGPQTHRLLKATLDVIDGRRCRQALSSAGGLPPHTFCTYTPGRDTCQYD 472

  Fly   232 SGGPLTARVRIGSERRVILFGVVSYG-AVHCFGPTVYTNVIHFANWI 277
            |||.|..|:    ..|::..|:||:| |.....|:|.|.|..|..||
  Fly   473 SGGALYERI----NGRLMAVGIVSFGQACAAQQPSVNTRVASFIKWI 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 64/240 (27%)
Tryp_SPc 42..280 CDD:238113 66/242 (27%)
CG14760NP_610366.1 CUB 37..126 CDD:294042
Tryp_SPc 281..516 CDD:238113 66/242 (27%)
Tryp_SPc 281..515 CDD:214473 64/240 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.