DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and KLK3

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001639.1 Gene:KLK3 / 354 HGNCID:6364 Length:261 Species:Homo sapiens


Alignment Length:263 Identity:78/263 - (29%)
Similarity:118/263 - (44%) Gaps:53/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LYRVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETKSQLTVRLGDY----- 98
            |.|::.|...:..|.||.|::..||...|||.|:.|::|||||||   .:::..:.||.:     
Human    22 LSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHC---IRNKSVILLGRHSLFHP 83

  Fly    99 -DVNQAVDCSSYGCIPRP---REINVTRTYVPSHYTNFRKNDIALLRLETTVQYGDNIRSICL-- 157
             |..|....|.  ..|.|   ..:...|...|...::   :|:.||||....:..|.::.:.|  
Human    84 EDTGQVFQVSH--SFPHPLYDMSLLKNRFLRPGDDSS---HDLMLLRLSEPAELTDAVKVMDLPT 143

  Fly   158 ---LMGDYTWSSNILKNLVKFNTTGWGRTESR--INSPVLQQASLTHHHLS--YCAQVFGKQLDK 215
               .:|...::|            |||..|..  :....||...|  |.:|  .||||..:::.|
Human   144 QEPALGTTCYAS------------GWGSIEPEEFLTPKKLQCVDL--HVISNDVCAQVHPQKVTK 194

  Fly   216 SHICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCF---GPTVYTNVIHFAN 275
            ..:|....||  |||.|||||||..        ..:|.|:.|:|:..|.   .|::||.|:|:..
Human   195 FMLCAGRWTGGKSTCSGDSGGPLVC--------NGVLQGITSWGSEPCALPERPSLYTKVVHYRK 251

  Fly   276 WIE 278
            ||:
Human   252 WIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 75/258 (29%)
Tryp_SPc 42..280 CDD:238113 76/260 (29%)
KLK3NP_001639.1 Tryp_SPc 25..256 CDD:238113 76/260 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.