DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG18478

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster


Alignment Length:312 Identity:79/312 - (25%)
Similarity:128/312 - (41%) Gaps:68/312 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLIALVFLKVQGQPHLL-----------DPQCVTARSEPGLYRVING--KPADLFSNPWMVIIIE 61
            |::||..|.|......|           :|..|..:     :.|..|  |||:.   ||.:.:|.
  Fly     7 LIVALFVLGVAENVENLQQIEELKCGYGNPDAVKVQ-----FNVTEGQAKPAEF---PWTIAVIH 63

  Fly    62 RGMMKCGGSLITPRYVLTAAH-CKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYV 125
            ...:..|||||||..|||||| ..::....:.|..|:::...|::...:      .|..|.:..:
  Fly    64 NRSLVGGGSLITPDIVLTAAHRIFNKDVEDIVVSAGEWEYGSALEKYPF------EEAFVLKMVI 122

  Fly   126 PSHYTNFRK--NDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLV------KFNTTGWGR 182
            ...: |:::  |::|||.|:........|.:|||.....:.||.  :.:|      :|:.|.:|.
  Fly   123 HKSF-NYQRGANNLALLFLDREFPLTYKINTICLPTQKRSLSST--RCIVAGWGKYQFSDTHYGG 184

  Fly   183 TESRINSPVLQQASLTHHHLSYCAQVFGK-------QLDKSHICV-ASSTGSTCQGDSGG----P 235
            ...:|:.|::.:      |:  |.....|       .|.:..||. .......|.||.||    |
  Fly   185 VLKKIDLPIVPR------HI--CQDQLRKTRLGQNYTLPRGLICAGGEKDNDACTGDGGGALFCP 241

  Fly   236 LTARVRIGSERRVILFGVVSYGAVHCFG---PTVYTNVIHFANWIELHTKKN 284
            :|.     ..::....|:|::| |.|..   |..||:|..|..||....|:|
  Fly   242 MTE-----DPKQFEQIGIVNWG-VGCKEKNVPATYTDVFEFKPWIVQQIKEN 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 67/261 (26%)
Tryp_SPc 42..280 CDD:238113 69/263 (26%)
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 67/258 (26%)
Tryp_SPc 50..280 CDD:214473 65/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.