DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG18477

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster


Alignment Length:290 Identity:81/290 - (27%)
Similarity:128/290 - (44%) Gaps:50/290 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QPHLL------DPQC--VTARSEPGLYRVINGKPADLFSNPWMVIIIE--RGMMKCGGSLITPRY 76
            :|.|:      ||||  |.::.....:|..:...|.....||||.:::  ......||:||.|..
  Fly    79 EPRLIINEPITDPQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHV 143

  Fly    77 VLTA-AHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYV--PSHYTNFRKNDIA 138
            |:|| ...::.|.|||.||.|::|.:...:......:|       .|:.|  |........|::|
  Fly   144 VITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVP-------IRSIVRHPGFNLENGANNVA 201

  Fly   139 LLRLETTVQYGDNIRSICLLMG--DYTWSSNILKNLVKFNTTGWGRTE----------SRINSPV 191
            |:.|..::....:|..||:...  ::.:|..|.        ||||:..          .:|:.||
  Fly   202 LVFLRRSLTSSRHINPICMPSAPKNFDFSRCIF--------TGWGKNSFDDPSYMNVLKKISLPV 258

  Fly   192 LQQASLTHHHLSYCAQVFGKQLDKSHICVASSTG-STCQGDSGGPLTARVRIGSERRVILFGVVS 255
            :|:.:.......|....|  :||.|.:|.....| .:|:||.|.||...:: .:.:|..|.|:|:
  Fly   259 VQRRTCEQQLRLYYGNDF--ELDNSLMCAGGEPGKDSCEGDGGSPLACAIK-DNPQRYELAGIVN 320

  Fly   256 YGAVHCFG----PTVYTNVIHFANWIELHT 281
            :| |.| |    |.|||||.:...||.|.|
  Fly   321 FG-VDC-GLPGVPAVYTNVANVIEWITLTT 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 70/257 (27%)
Tryp_SPc 42..280 CDD:238113 71/259 (27%)
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 69/250 (28%)
Tryp_SPc 113..344 CDD:238113 69/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.