DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:261 Identity:77/261 - (29%)
Similarity:114/261 - (43%) Gaps:31/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETKS----QLTVRLGD 97
            |...|::.|..|.....||:.::.:.|...|||||||..::||||||.:...|    .||..|||
  Fly   395 PDQERIVGGINASPHEFPWIAVLFKSGKQFCGGSLITNSHILTAAHCVARMTSWDVAALTAHLGD 459

  Fly    98 YDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRKNDIALLRLETTVQYGDNIRSICLLMGDY 162
            |::....:.....     |.|.....:....::... ||:|:|.|...|.:...|:.|||.....
  Fly   460 YNIGTDFEVQHVS-----RRIKRLVRHKGFEFSTLH-NDVAILTLSEPVPFTREIQPICLPTSPS 518

  Fly   163 TWSSNILKNLVKFNTTGWGRTESRINSP---VLQQASLTHHHLSYCAQVFGKQ----LDKSHICV 220
            ..|.:....:.  ...|||  ..|.|.|   :||:..:.....:.||:.:|:.    :.:|.||.
  Fly   519 QQSRSYSGQVA--TVAGWG--SLRENGPQPSILQKVDIPIWTNAECARKYGRAAPGGIIESMICA 579

  Fly   221 ASSTGSTCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG----PTVYTNVIHFANWIELHT 281
            ..:...:|.||||||:.    |....|....|:||:| :.| |    |.|||.|.....||..:.
  Fly   580 GQAAKDSCSGDSGGPMV----INDGGRYTQVGIVSWG-IGC-GKGQYPGVYTRVTSLLPWIYKNI 638

  Fly   282 K 282
            |
  Fly   639 K 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 73/250 (29%)
Tryp_SPc 42..280 CDD:238113 74/252 (29%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 73/250 (29%)
Tryp_SPc 400..637 CDD:238113 74/252 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.