DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG5390

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:269 Identity:75/269 - (27%)
Similarity:117/269 - (43%) Gaps:74/269 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PWMVIII-ERG---MMKCGGSLITPRYVLTAAHC-KSETKSQLTVRLGDYDVNQAVDCSSYGCIP 113
            |||:.|: |.|   :.:|||:||.|..||||||| .::..|.:.||.|::|.....:.       
  Fly   161 PWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEI------- 218

  Fly   114 RPREINVTRTYVPSHYTNFRK----NDIALLRLETTVQYGDNIRSICL-LMGDYTWSSNILKNLV 173
            |..|....:..:  ::..|.|    ||:|::.||:.....:||:::|| .:||            
  Fly   219 RRHEDRYVKEII--YHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGD------------ 269

  Fly   174 KFN-----TTGWGRTE-----------SRINSPV---------LQQASLTHHHLSYCAQVFGKQL 213
            ||:     .||||:.:           .:::.||         |::..|..|.:          |
  Fly   270 KFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFI----------L 324

  Fly   214 DKSHICVASSTG-STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG----PTVYTNVIHF 273
            ..|.||...... .||:||.|.||...: .|.:.|....|:|::| :.| |    |.||.:|...
  Fly   325 HDSFICAGGEKDKDTCKGDGGSPLVCPI-AGQKNRFKSAGIVAWG-IGC-GEVNIPGVYASVAKL 386

  Fly   274 ANWIELHTK 282
            ..||:...|
  Fly   387 RPWIDAKLK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 72/262 (27%)
Tryp_SPc 42..280 CDD:238113 74/265 (28%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 73/263 (28%)
Tryp_SPc 153..390 CDD:214473 72/262 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.