DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and Try29F

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:271 Identity:69/271 - (25%)
Similarity:105/271 - (38%) Gaps:84/271 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGMMKCGGSLITPRYVLTAAHCKSETKSQLT-VRLGDYDVNQAV 104
            |::.|:.|::...|:.| .::|....||||||...:|||||||...:...|: ||:|.       
  Fly    41 RIVGGQVANIKDIPYQV-SLQRSYHFCGGSLIAQGWVLTAAHCTEGSAILLSKVRIGS------- 97

  Fly   105 DCSSYGCIPRPREINVTRTYVPSHYTNFRK-------------NDIALLRLETTVQYGDNIRSIC 156
                            :||.|.......::             .|.:||.||             
  Fly    98 ----------------SRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELE------------- 133

  Fly   157 LLMGDYTWSSNILKNLVKFN-------------TTGWGRTES-RINSPVLQQASLTHHHLSYCAQ 207
                :|: :.|:.:..|...             .:|||.|:| :..|.||:..::.....:.|.:
  Fly   134 ----EYS-AKNVTQAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQCTE 193

  Fly   208 VFGK--QLDKSHICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVS--YGAVHCFGPTV 266
            .:|.  .:....:|.....|  ..|||||||||.|        ..:|:||||  ||......|.|
  Fly   194 AYGNFGSITDRMLCAGLPEGGKDACQGDSGGPLAA--------DGVLWGVVSWGYGCARPNYPGV 250

  Fly   267 YTNVIHFANWI 277
            |:.|....:||
  Fly   251 YSRVSAVRDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 67/269 (25%)
Tryp_SPc 42..280 CDD:238113 68/270 (25%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 67/269 (25%)
Tryp_SPc 42..264 CDD:238113 68/270 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.