DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CG40160

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster


Alignment Length:283 Identity:82/283 - (28%)
Similarity:113/283 - (39%) Gaps:56/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PQCVTARSEPGLYRVING---KPADLFSNPWMVIIIERGMMK--CGGSLITPRYVLTAAHC-KSE 86
            |:....|:..||...::|   ..|.....||.|.::..|.:.  |.||||..:.||||||| :|.
  Fly   148 PRGCGVRNTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAHCVESL 212

  Fly    87 TKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRKN---DIALLRLETTVQY 148
            .....|||.|::|.....:...|      :|.:|....:...|.  |::   |.||:.|...|..
  Fly   213 RTGSFTVRAGEWDTQTMKERLPY------QERSVQTVILHPDYN--RRSIAYDFALVILSQPVTL 269

  Fly   149 GDNIRSICLLMGDYTWSSNILKNLVKFNT---TGWGRTE-----------SRINSPVLQ----QA 195
            .|:|..|||...|......        ||   ||||:..           .|:..|:::    |.
  Fly   270 DDHINVICLPQQDDIPQPG--------NTCFSTGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQT 326

  Fly   196 SLTHHHLSYCAQVFGKQ--LDKSHICVASSTG-STCQGDSGGPLTARVRIGSERRVILFGVVSYG 257
            .|....|       |.:  ||:|.||.....| .|||||.|.||........|.|....|:|::|
  Fly   327 RLRGTRL-------GPKFALDRSFICAGGQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWG 384

  Fly   258 AVHCFG--PTVYTNVIHFANWIE 278
             :.|..  |..|.||.....||:
  Fly   385 -IGCNDEVPAAYANVALVRGWID 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 76/267 (28%)
Tryp_SPc 42..280 CDD:238113 78/269 (29%)
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 77/265 (29%)
Tryp_SPc 169..405 CDD:214473 75/259 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.