DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP008997

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_319746.4 Gene:AgaP_AGAP008997 / 3291872 VectorBaseID:AGAP008997 Length:248 Species:Anopheles gambiae


Alignment Length:259 Identity:87/259 - (33%)
Similarity:133/259 - (51%) Gaps:45/259 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVINGKPADLFSNPWMVIIIERGM----MKCGGSLITPRYVLTAAHCKSETKSQLTVRLGDYDVN 101
            |::.|..:...::||...:|:.|.    :.|||:||:.|:|:|||||   ..:.|.||||::||.
Mosquito     7 RIVGGHSSGFGTHPWQAALIKSGFLTKKLSCGGALISNRWVVTAAHC---VATNLKVRLGEWDVR 68

  Fly   102 QAVDCSSYGCIPRPREINVTRTYVPSHY--TNFRKNDIALLRLETTVQYGDNIRSICLLMGDYTW 164
            ...:..::      .|.::.|..|..:|  ::|| |||||::|:..|.:..:|..:||       
Mosquito    69 DQEERLTH------EEYSIERKEVHPNYSPSDFR-NDIALVKLDRKVVFRQHILPVCL------- 119

  Fly   165 SSNILKNLVKFNT-TGWGRT---ESRINSPVLQQASLTHHHLSYCAQVF---GKQ--LDKSHICV 220
            ....:|.:.|..| .|||||   :|.:.| |||:..:.......|.:.|   |::  :....:|.
Mosquito   120 PPKSVKLVGKMATVAGWGRTRHGQSTVPS-VLQEVDVEVIPNERCQRWFRAAGRRETIHDVFLCA 183

  Fly   221 ASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCFG----PTVYTNVIHFANWIE 278
            ....|  .:||||||||||..:    |.|..|.|:||:| :.| |    |.||||:..|..|||
Mosquito   184 GYKEGGRDSCQGDSGGPLTLSI----EGRKTLIGLVSWG-IGC-GREHLPGVYTNIQKFVPWIE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 84/256 (33%)
Tryp_SPc 42..280 CDD:238113 86/258 (33%)
AgaP_AGAP008997XP_319746.4 Tryp_SPc 7..240 CDD:214473 84/256 (33%)
Tryp_SPc 8..243 CDD:238113 86/258 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.