DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and CLIPC1

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_552698.3 Gene:CLIPC1 / 3291827 VectorBaseID:AGAP008835 Length:389 Species:Anopheles gambiae


Alignment Length:296 Identity:87/296 - (29%)
Similarity:121/296 - (40%) Gaps:87/296 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SEPGLYR-----------VINGKPADLFSNPWMVIIIERGMMK-------CGGSLITPRYVLTAA 81
            |||.|..           :::|:.|.....|.|.:|   |..:       |||||::.|::|||.
Mosquito   125 SEPKLQTIDKCGHTAVELIVDGELAKAREFPHMALI---GFGEAPEIRYLCGGSLVSDRFILTAG 186

  Fly    82 HCKSETK--SQLTVRLG--------------DYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYT 130
            ||.:.|.  ....||||              |||:.:.        ||.| |...|     ||| 
Mosquito   187 HCLTSTNFGPATIVRLGELSLASSTDEAFPEDYDIAER--------IPHP-EYKQT-----SHY- 236

  Fly   131 NFRKNDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRI-NSPVLQQ 194
                |||||::|...|.:....|.|||.:.........:       .||||.....: .|..|.:
Mosquito   237 ----NDIALIKLNRKVIFSPYARPICLPLQAAIPQKRAI-------ATGWGAIGFGLEQSSALLK 290

  Fly   195 ASLTHHHLSYCAQVF--GKQL-----DKSHICVAS--STGSTCQGDSGGPLTARVRIGSERRV-- 248
            .:|.......|...|  .::|     ..:.:|..|  ||..||||||||||    ::.::..|  
Mosquito   291 VTLDMFRFEECKDQFEPTRKLRTGLNATTQLCAGSRNSTKDTCQGDSGGPL----QVYNDANVYC 351

  Fly   249 --ILFGVVSYGAVHCFG----PTVYTNVIHFANWIE 278
              .:.||.|:|. :| |    |.|||.|..:.:|||
Mosquito   352 TYTIIGVTSFGQ-NC-GLAGVPAVYTTVYSYLSWIE 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 80/287 (28%)
Tryp_SPc 42..280 CDD:238113 83/278 (30%)
CLIPC1XP_552698.3 CLIP 39..79 CDD:197829
Tryp_SPc 143..386 CDD:238113 83/278 (30%)
Tryp_SPc 143..384 CDD:214473 80/275 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.