DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30287 and AgaP_AGAP008276

DIOPT Version :9

Sequence 1:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_555189.1 Gene:AgaP_AGAP008276 / 3291691 VectorBaseID:AGAP008276 Length:272 Species:Anopheles gambiae


Alignment Length:277 Identity:79/277 - (28%)
Similarity:123/277 - (44%) Gaps:39/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLLIALVFLKVQGQPHLLDPQCVTARSEPGLYRVINGKPADLFSNPWMVIIIERGMMKCGGSLI 72
            |.:::|.:.|.:...     .|....|.:.....::.|...|:...|:...|:..|.:.||||:|
Mosquito    10 LAVVLAAISLPISSA-----QQQQEERDDSATNMIVGGMKVDIEQVPYQAAILTLGQVHCGGSII 69

  Fly    73 TPRYVLTAAHCKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPRE---INVTRTYVPSHYTNFRK 134
            .||:||||.||........      |:|  ||..::      |.|   |.|...:||....:...
Mosquito    70 GPRWVLTAYHCVDWLLPNF------YEV--AVGSTN------PYEGQRILVQELFVPLETLSDPN 120

  Fly   135 NDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLVKFNTTGWGRTESRINSPVLQQASLTH 199
            .||||.:|..|:||...::.|.||..|    |:::.:...: .:|:|.|:.|.:..:|:.|.:..
Mosquito   121 FDIALAKLAHTLQYSSTVQCIPLLTSD----SSLIPDTPAY-ISGFGYTKERASDNILKAAQIKV 180

  Fly   200 HHLSYCAQVFGKQLDKSHICVASSTG--STCQGDSGGPLTARVRIGSERRVILFGVVSY--GAVH 260
            ....||.|.:...:.:..:|.....|  .:|||||||||....:        |.|||.|  |...
Mosquito   181 LPWDYCQQAYPYLMREFMLCAGFKEGKVDSCQGDSGGPLIVNAK--------LAGVVFYGEGCAR 237

  Fly   261 CFGPTVYTNVIHFANWI 277
            ...|.||.:|..|::||
Mosquito   238 PHFPGVYISVPWFSDWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 72/242 (30%)
Tryp_SPc 42..280 CDD:238113 74/243 (30%)
AgaP_AGAP008276XP_555189.1 Tryp_SPc 39..257 CDD:238113 74/243 (30%)
Tryp_SPc 39..254 CDD:214473 72/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.